SCOP 1.57: Domain d1fuub2: 1fuu B:226-394

Lineage for d1fuub2 (1fuu B:226-394)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families)

5. Family c.37.1.13: Extended AAA-ATPase domain [52700] (15 proteins)

6. Protein Initiation factor 4a [52706] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52707] (4 PDB entries)

8. Domain d1fuub2: 1fuu B:226-394 [32414]

Details for d1fuub2

PDB Entry: 1fuu, 2.5 Å

PDB Description: yeast initiation factor 4a

SCOP Domain Sequences for d1fuub2:

Sequence, based on SEQRES records:

>d1fuub2 c.37.1.13 (B:226-394) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae)}
deltlegikqfyvnveeeeykyecltdlydsisvtqavifcntrrkveelttklrndkft
vsaiysdlpqqerdtimkefrsgssrilistdllargidvqqvslvinydlpankenyih
rigrggrfgrkgvainfvtnedvgamrelekfystqieelpsdiatlln

Sequence, based on observed residues (ATOM records):

>d1fuub2 c.37.1.13 (B:226-394) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae)}
deltlegikqfyvnveeeeykyecltdlydsisvtqavifcntrrkveelttklrndkft
vsaiysdlpqqerdtimkefrsgssrilistdllargidvqqvslvinydlpankenyih
rigrggkgvainfvtnedvgamrelekfystqieelpsdiatlln

Timeline for d1fuub2:

• d1fuub2 first appeared (with stable ids) in SCOP 1.55
  
• d1fuub2 appears in SCOP 1.59
  
• d1fuub2 appears in the current release, SCOPe 2.08