Lineage for d5lnpd1 (5lnp D:416-508)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693893Family a.4.5.31: DEP domain [63483] (5 proteins)
    membrane-binding domain
  6. 2693909Protein automated matches [324001] (1 species)
    not a true protein
  7. 2693910Species Human (Homo sapiens) [TaxId:9606] [324002] (3 PDB entries)
  8. 2693920Domain d5lnpd1: 5lnp D:416-508 [324136]
    Other proteins in same PDB: d5lnpa2, d5lnpb2, d5lnpc2, d5lnpd2
    automated match to d1fsha_
    complexed with so4

Details for d5lnpd1

PDB Entry: 5lnp (more details), 1.99 Å

PDB Description: domain-swapped dimer of human dishevelled2 dep domain: monoclinic crystal form crystallised from monomeric fraction
PDB Compounds: (D:) Segment polarity protein dishevelled homolog DVL-2

SCOPe Domain Sequences for d5lnpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lnpd1 a.4.5.31 (D:416-508) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glsvhtdmasvtkamaapesglevrdrmwlkitipnaflgsdvvdwlyhhvegfperrea
rkyasgllkaglirhtvnkitfseqcyyvfgdl

SCOPe Domain Coordinates for d5lnpd1:

Click to download the PDB-style file with coordinates for d5lnpd1.
(The format of our PDB-style files is described here.)

Timeline for d5lnpd1: