Lineage for d5e5mb_ (5e5m B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744738Domain d5e5mb_: 5e5m B: [324133]
    Other proteins in same PDB: d5e5ma_, d5e5mc_, d5e5me_, d5e5mg_
    automated match to d4y5va_
    complexed with gol

Details for d5e5mb_

PDB Entry: 5e5m (more details), 2.18 Å

PDB Description: crystal structure of mouse ctla-4 in complex with nanobody
PDB Compounds: (B:) CTLA-4 nanobody

SCOPe Domain Sequences for d5e5mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e5mb_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlvesggglaqpggslrlscaasgstissvavgwyrqtpgnqrewvatsstssttaty
adsvkgrftisrdnakntiylqmnslkpedtavyycktgltnwgrgtqvtvs

SCOPe Domain Coordinates for d5e5mb_:

Click to download the PDB-style file with coordinates for d5e5mb_.
(The format of our PDB-style files is described here.)

Timeline for d5e5mb_: