![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
![]() | Domain d5e5mb_: 5e5m B: [324133] Other proteins in same PDB: d5e5ma_, d5e5mc_, d5e5me_, d5e5mg_ automated match to d4y5va_ complexed with gol |
PDB Entry: 5e5m (more details), 2.18 Å
SCOPe Domain Sequences for d5e5mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e5mb_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qvqlvesggglaqpggslrlscaasgstissvavgwyrqtpgnqrewvatsstssttaty adsvkgrftisrdnakntiylqmnslkpedtavyycktgltnwgrgtqvtvs
Timeline for d5e5mb_: