Lineage for d1fuub1 (1fuu B:11-225)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70260Family c.37.1.13: Extended AAA-ATPase domain [52700] (15 proteins)
  6. 70353Protein Initiation factor 4a [52706] (1 species)
  7. 70354Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52707] (4 PDB entries)
  8. 70359Domain d1fuub1: 1fuu B:11-225 [32413]

Details for d1fuub1

PDB Entry: 1fuu (more details), 2.5 Å

PDB Description: yeast initiation factor 4a

SCOP Domain Sequences for d1fuub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fuub1 c.37.1.13 (B:11-225) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae)}
qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciggtsfv
edaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftll
ppttqvvllsatmpndvlevttkfmrnpvrilvkk

SCOP Domain Coordinates for d1fuub1:

Click to download the PDB-style file with coordinates for d1fuub1.
(The format of our PDB-style files is described here.)

Timeline for d1fuub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fuub2
View in 3D
Domains from other chains:
(mouse over for more information)
d1fuua1