SCOPe 2.08: Domain d1fuub1: 1fuu B:11-225

Lineage for d1fuub1 (1fuu B:11-225)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Initiation factor 4a [52706] (2 species)
   homologous to UvrB

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52707] (4 PDB entries)

8. Domain d1fuub1: 1fuu B:11-225 [32413]

Details for d1fuub1

PDB Entry: 1fuu, 2.5 Å

PDB Description: yeast initiation factor 4a

PDB Compounds: (B:) yeast initiation factor 4a

SCOPe Domain Sequences for d1fuub1:

Sequence; same for both SEQRES and ATOM records:

>d1fuub1 c.37.1.19 (B:11-225) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciggtsfv
edaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftll
ppttqvvllsatmpndvlevttkfmrnpvrilvkk

Timeline for d1fuub1:

• d1fuub1 first appeared (with stable ids) in SCOP 1.55
  
• d1fuub1 appears in SCOPe 2.07