SCOPe 2.08: Domain d5l4jb_: 5l4j B:

Lineage for d5l4jb_ (5l4j B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
   Uniprot P02766 31-143

8. Domain d5l4jb_: 5l4j B: [324127]
   automated match to d1f41a_
   complexed with 6jd, na

Details for d5l4jb_

PDB Entry: 5l4j, 1.62 Å

PDB Description: crystal structure of human transthyretin in complex with 4,4'- dihydroxydiphenyl sulfone (bisphenol s, bps)

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d5l4jb_:

Sequence; same for both SEQRES and ATOM records:

>d5l4jb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

Timeline for d5l4jb_:

• d5l4jb_ first appeared in SCOPe 2.06
  
• d5l4jb_ appears in SCOPe 2.07