![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.31: DEP domain [63483] (5 proteins) membrane-binding domain |
![]() | Protein automated matches [324001] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [324002] (3 PDB entries) |
![]() | Domain d5suyb1: 5suy B:416-508 [324119] Other proteins in same PDB: d5suya2, d5suyb2, d5suyc2 automated match to d1fsha_ complexed with so4 |
PDB Entry: 5suy (more details), 1.88 Å
SCOPe Domain Sequences for d5suyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5suyb1 a.4.5.31 (B:416-508) automated matches {Human (Homo sapiens) [TaxId: 9606]} glsvhtdmasvtkamaapesglevrdrmwlkitipnaflgsdvvdwlyhhvegfperrea rkyasgllkaglirhtvnkitfseqcyyvfgdl
Timeline for d5suyb1: