Lineage for d4yqvb2 (4yqv B:103-241)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713157Protein Class omega GST [81352] (1 species)
  7. 2713158Species Human (Homo sapiens) [TaxId:9606] [47632] (17 PDB entries)
  8. 2713171Domain d4yqvb2: 4yqv B:103-241 [324111]
    Other proteins in same PDB: d4yqva1, d4yqvb1, d4yqvc1
    automated match to d1eema1
    complexed with 4gg

Details for d4yqvb2

PDB Entry: 4yqv (more details), 2.06 Å

PDB Description: glutathione s-transferase omega 1 bound to covalent inhibitor c4-10
PDB Compounds: (B:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d4yqvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yqvb2 a.45.1.1 (B:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
lpddpyekacqkmilelfskvpslvgsfirsqnkedyaglkeefrkeftkleevltnkkt
tffggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdw
qgflelylqnspeacdygl

SCOPe Domain Coordinates for d4yqvb2:

Click to download the PDB-style file with coordinates for d4yqvb2.
(The format of our PDB-style files is described here.)

Timeline for d4yqvb2: