SCOPe 2.08: Domain d5suza1: 5suz A:416-509

Lineage for d5suza1 (5suz A:416-509)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.31: DEP domain [63483] (5 proteins)
   membrane-binding domain

6. Protein automated matches [324001] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [324002] (3 PDB entries)

8. Domain d5suza1: 5suz A:416-509 [324108]
   Other proteins in same PDB: d5suza2, d5suzb2
   automated match to d1fsha_

Details for d5suza1

PDB Entry: 5suz, 1.84 Å

PDB Description: domain-swapped dimer of human dishevelled2 dep domain: c-centered monoclinic crystal form crystallised from monomeric fraction

PDB Compounds: (A:) Segment polarity protein dishevelled homolog DVL-2

SCOPe Domain Sequences for d5suza1:

Sequence; same for both SEQRES and ATOM records:

>d5suza1 a.4.5.31 (A:416-509) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glsvhtdmasvtkamaapesglevrdrmwlkitipnaflgsdvvdwlyhhvegfperrea
rkyasgllkaglirhtvnkitfseqcyyvfgdls

Timeline for d5suza1:

• d5suza1 first appeared in SCOPe 2.06
  
• d5suza1 appears in SCOPe 2.07