Lineage for d1qdea_ (1qde A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70260Family c.37.1.13: Extended AAA-ATPase domain [52700] (15 proteins)
  6. 70353Protein Initiation factor 4a [52706] (1 species)
  7. 70354Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52707] (4 PDB entries)
  8. 70356Domain d1qdea_: 1qde A: [32410]

Details for d1qdea_

PDB Entry: 1qde (more details), 2 Å

PDB Description: crystal structure of the atpase domain of translation initiation factor 4a from saccharomyces cerevisiae-the prototype of the dead box protein family

SCOP Domain Sequences for d1qdea_:

Sequence, based on SEQRES records: (download)

>d1qdea_ c.37.1.13 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae)}
iqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtgk
tgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciggtsfve
daeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftllp
pttqvvllsatmpndvlevttkfmrnpvrilv

Sequence, based on observed residues (ATOM records): (download)

>d1qdea_ c.37.1.13 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae)}
iqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtgk
tgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhacigglrdaq
ivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftllppttqvvlls
atmpndvlevttkfmrnpvrilv

SCOP Domain Coordinates for d1qdea_:

Click to download the PDB-style file with coordinates for d1qdea_.
(The format of our PDB-style files is described here.)

Timeline for d1qdea_: