SCOPe 2.08: Domain d5t8za1: 5t8z A:1-169

Lineage for d5t8za1 (5t8z A:1-169)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (20 species)
   not a true protein

7. Species Burkholderia multivorans [TaxId:395019] [315513] (2 PDB entries)

8. Domain d5t8za1: 5t8z A:1-169 [324099]
   Other proteins in same PDB: d5t8za2
   automated match to d3dlda_
   complexed with bb2, fe2

Details for d5t8za1

PDB Entry: 5t8z, 1.85 Å

PDB Description: crystal structure of a peptide deformylase from burkholderia multivorans in complex with actinonin

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d5t8za1:

Sequence, based on SEQRES records:

>d5t8za1 d.167.1.0 (A:1-169) automated matches {Burkholderia multivorans [TaxId: 395019]}
mireilkmgdprllevarpvdrfdtpelheivadmfetmhhangaglaapqigiglqiii
fgfgsndrypdappvpetvlinpkleymppdmeegwegclsvpgmrgvvsryakvrysgf
dqfgakidrvaegfharvvqheydhligklypmritdftrfgftevlfp

Sequence, based on observed residues (ATOM records):

>d5t8za1 d.167.1.0 (A:1-169) automated matches {Burkholderia multivorans [TaxId: 395019]}
mireilkmgdprllevarpvdrfdtpelheivadmfetmhhangaglaapqigiglqiii
fgfppvpetvlinpkleymppdmeegwegclsvpgmrgvvsryakvrysgfdqfgakidr
vaegfharvvqheydhligklypmritdftrfgftevlfp

Timeline for d5t8za1:

• d5t8za1 first appeared in SCOPe 2.06
  
• d5t8za1 appears in SCOPe 2.07