SCOPe 2.08: Domain d5grul1: 5gru L:1-118

Lineage for d5grul1 (5gru L:1-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5grul1: 5gru L:1-118 [324093]
   Other proteins in same PDB: d5grua_
   automated match to d3auva2

Details for d5grul1

PDB Entry: 5gru, 1.96 Å

PDB Description: structure of mono-specific diabody

PDB Compounds: (L:) diabody protein

SCOPe Domain Sequences for d5grul1:

Sequence; same for both SEQRES and ATOM records:

>d5grul1 b.1.1.0 (L:1-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlkesgpglvrpsqslsltcsvtgysitsgyywnwirqfpgnklewmgyisydgsnny
npslkgrisitrdtsknqfflklnsvttddtatyycarayigfaywgqgtlvtvssgg

Timeline for d5grul1:

• d5grul1 first appeared in SCOPe 2.06
  
• d5grul1 appears in SCOPe 2.07