Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) share the common active site structure with the family II |
Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins) automatically mapped to Pfam PF01451 |
Protein Tyrosine phosphatase [52790] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [52792] (13 PDB entries) |
Domain d5kqga_: 5kqg A: [324092] automated match to d5pnta_ complexed with 6vx |
PDB Entry: 5kqg (more details), 1.5 Å
SCOPe Domain Sequences for d5kqga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kqga_ c.44.1.1 (A:) Tyrosine phosphatase {Human (Homo sapiens) [TaxId: 9606]} atksvlfvclgnicrspiaeavfrklvtdqnisenwrvdsaatsgyeignppdyrgqscm krhgipmshvarqitkedfatfdyilcmdesnlrdlnrksnqvktckakiellgsydpqk qliiedpyygndsdfetvyqqcvrccraflekah
Timeline for d5kqga_: