![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) ![]() |
![]() | Family c.37.1.13: Extended AAA-ATPase domain [52700] (16 proteins) |
![]() | Protein Putative DEAD box RNA helicase [52704] (1 species) |
![]() | Species Archaeon Methanococcus jannaschii [TaxId:2190] [52705] (1 PDB entry) |
![]() | Domain d1hv8b2: 1hv8 B:211-365 [32408] |
PDB Entry: 1hv8 (more details), 3 Å
SCOP Domain Sequences for d1hv8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hv8b2 c.37.1.13 (B:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii} nanieqsyvevnenerfealcrllknkefyglvfcktkrdtkelasmlrdigfkagaihg dlsqsqrekvirlfkqkkiriliatdvmsrgidvndlncvinyhlpqnpesymhrigrtg ragkkgkaisiinrreykklryieramklkikklk
Timeline for d1hv8b2: