SCOPe 2.08: Domain d1hv8b2: 1hv8 B:211-365

Lineage for d1hv8b2 (1hv8 B:211-365)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Putative DEAD box RNA helicase [52704] (1 species)
   homologous to eIF4a and UvrB

7. Species Methanococcus jannaschii [TaxId:2190] [52705] (1 PDB entry)

8. Domain d1hv8b2: 1hv8 B:211-365 [32408]
   complexed with so4

Details for d1hv8b2

PDB Entry: 1hv8, 3 Å

PDB Description: crystal structure of a dead box protein from the hyperthermophile methanococcus jannaschii

PDB Compounds: (B:) putative ATP-dependent RNA helicase mj0669

SCOPe Domain Sequences for d1hv8b2:

Sequence; same for both SEQRES and ATOM records:

>d1hv8b2 c.37.1.19 (B:211-365) Putative DEAD box RNA helicase {Methanococcus jannaschii [TaxId: 2190]}
nanieqsyvevnenerfealcrllknkefyglvfcktkrdtkelasmlrdigfkagaihg
dlsqsqrekvirlfkqkkiriliatdvmsrgidvndlncvinyhlpqnpesymhrigrtg
ragkkgkaisiinrreykklryieramklkikklk

Timeline for d1hv8b2:

• d1hv8b2 first appeared (with stable ids) in SCOP 1.55
  
• d1hv8b2 appears in SCOPe 2.07