| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
| Protein Putative DEAD box RNA helicase [52704] (1 species) homologous to eIF4a and UvrB |
| Species Methanococcus jannaschii [TaxId:2190] [52705] (1 PDB entry) |
| Domain d1hv8b2: 1hv8 B:211-365 [32408] complexed with so4 |
PDB Entry: 1hv8 (more details), 3 Å
SCOPe Domain Sequences for d1hv8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hv8b2 c.37.1.19 (B:211-365) Putative DEAD box RNA helicase {Methanococcus jannaschii [TaxId: 2190]}
nanieqsyvevnenerfealcrllknkefyglvfcktkrdtkelasmlrdigfkagaihg
dlsqsqrekvirlfkqkkiriliatdvmsrgidvndlncvinyhlpqnpesymhrigrtg
ragkkgkaisiinrreykklryieramklkikklk
Timeline for d1hv8b2: