Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class omega GST [81352] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47632] (17 PDB entries) |
Domain d4yqmc2: 4yqm C:103-241 [324075] Other proteins in same PDB: d4yqma1, d4yqmb1, d4yqmc1 automated match to d1eema1 complexed with 4g9, mes |
PDB Entry: 4yqm (more details), 2.38 Å
SCOPe Domain Sequences for d4yqmc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yqmc2 a.45.1.1 (C:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} lpddpyekacqkmilelfskvpslvgsfirsqnkedyaglkeefrkeftkleevltnkkt tffggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdw qgflelylqnspeacdygl
Timeline for d4yqmc2:
View in 3D Domains from other chains: (mouse over for more information) d4yqma1, d4yqma2, d4yqmb1, d4yqmb2 |