![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
![]() | Protein Class omega GST [81363] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52877] (17 PDB entries) |
![]() | Domain d4yqmc1: 4yqm C:5-102 [324074] Other proteins in same PDB: d4yqma2, d4yqmb2, d4yqmc2 automated match to d1eema2 complexed with 4g9, mes |
PDB Entry: 4yqm (more details), 2.38 Å
SCOPe Domain Sequences for d4yqmc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yqmc1 c.47.1.5 (C:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} sarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpewff kknpfglvpvlensqgqliyesaitceyldeaypgkkl
Timeline for d4yqmc1:
![]() Domains from other chains: (mouse over for more information) d4yqma1, d4yqma2, d4yqmb1, d4yqmb2 |