SCOPe 2.08: Domain d5k24a_: 5k24 A:

Lineage for d5k24a_ (5k24 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein automated matches [190696] (6 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [321215] (4 PDB entries)

8. Domain d5k24a_: 5k24 A: [324072]
   automated match to d2mbca_
   complexed with flc

Details for d5k24a_

PDB Entry: 5k24, 3.1 Å

PDB Description: crystal structure of the complex between phosphatase prl-2 in the oxidized state with the bateman domain of murine magnesium transporter cnnm3

PDB Compounds: (A:) Protein tyrosine phosphatase type IVA 2

SCOPe Domain Sequences for d5k24a_:

Sequence; same for both SEQRES and ATOM records:

>d5k24a_ c.45.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rpapveisyenmrflithnptnatlnkfteelkkygvttlvrvcdatydkapvekegihv
ldwpfddgapppnqivddwlnllktkfreepgccvavhcvaglgrapvlvalaliecgmk
yedavqfirqkrrgafnskqllylekyrpkmr

Timeline for d5k24a_:

• d5k24a_ first appeared in SCOPe 2.06
  
• d5k24a_ appears in SCOPe 2.07