SCOP 1.61: Domain d1hv8b1: 1hv8 B:3-210

Lineage for d1hv8b1 (1hv8 B:3-210)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families)

5. Family c.37.1.13: Extended AAA-ATPase domain [52700] (17 proteins)

6. Protein Putative DEAD box RNA helicase [52704] (1 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [52705] (1 PDB entry)

8. Domain d1hv8b1: 1hv8 B:3-210 [32407]

Details for d1hv8b1

PDB Entry: 1hv8, 3 Å

PDB Description: crystal structure of a dead box protein from the hyperthermophile methanococcus jannaschii

SCOP Domain Sequences for d1hv8b1:

Sequence; same for both SEQRES and ATOM records:

>d1hv8b1 c.37.1.13 (B:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii}
veymnfnelnlsdnilnairnkgfekptdiqmkviplflndeynivaqartgsgktasfa
iplielvnenngieaiiltptrelaiqvadeieslkgnknlkiakiyggkaiypqikalk
nanivvgtpgrildhinrgtlnlknvkyfildeademlnmgfikdvekilnacnkdkril
lfsatmpreilnlakkymgdysfikaki

Timeline for d1hv8b1:

• d1hv8b1 first appeared (with stable ids) in SCOP 1.55
  
• d1hv8b1 appears in SCOP 1.59
  
• d1hv8b1 appears in SCOP 1.63
  
• d1hv8b1 appears in the current release, SCOPe 2.08