SCOPe 2.08: Domain d4yqva2: 4yqv A:103-241

Lineage for d4yqva2 (4yqv A:103-241)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class omega GST [81352] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47632] (17 PDB entries)

8. Domain d4yqva2: 4yqv A:103-241 [324063]
   Other proteins in same PDB: d4yqva1, d4yqvb1, d4yqvc1
   automated match to d1eema1
   complexed with 4gg

Details for d4yqva2

PDB Entry: 4yqv, 2.06 Å

PDB Description: glutathione s-transferase omega 1 bound to covalent inhibitor c4-10

PDB Compounds: (A:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d4yqva2:

Sequence; same for both SEQRES and ATOM records:

>d4yqva2 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
lpddpyekacqkmilelfskvpslvgsfirsqnkedyaglkeefrkeftkleevltnkkt
tffggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdw
qgflelylqnspeacdygl

Timeline for d4yqva2:

• d4yqva2 first appeared in SCOPe 2.06
  
• d4yqva2 appears in SCOPe 2.07