SCOPe 2.08: Domain d4yqub1: 4yqu B:5-102

Lineage for d4yqub1 (4yqu B:5-102)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class omega GST [81363] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52877] (17 PDB entries)

8. Domain d4yqub1: 4yqu B:5-102 [324060]
   Other proteins in same PDB: d4yqua2, d4yqub2
   automated match to d1eema2
   complexed with 4gb, mes

Details for d4yqub1

PDB Entry: 4yqu, 1.94 Å

PDB Description: glutathione s-transferase omega 1 bound to covalent inhibitor c1-31

PDB Compounds: (B:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d4yqub1:

Sequence; same for both SEQRES and ATOM records:

>d4yqub1 c.47.1.5 (B:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
sarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpewff
kknpfglvpvlensqgqliyesaitceyldeaypgkkl

Timeline for d4yqub1:

• d4yqub1 first appeared in SCOPe 2.06
  
• d4yqub1 appears in SCOPe 2.07