SCOP 1.65: Domain d1hv8a2: 1hv8 A:211-365

Lineage for d1hv8a2 (1hv8 A:211-365)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.19: Tandem AAA-ATPase domain [81268] (6 proteins)
   duplication: tandem repeat of two RecA-like (AAA) domains

6. Protein Putative DEAD box RNA helicase [52704] (1 species)
   homologous to eIF4a and UrvB

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [52705] (1 PDB entry)

8. Domain d1hv8a2: 1hv8 A:211-365 [32406]

Details for d1hv8a2

PDB Entry: 1hv8, 3 Å

PDB Description: crystal structure of a dead box protein from the hyperthermophile methanococcus jannaschii

SCOP Domain Sequences for d1hv8a2:

Sequence; same for both SEQRES and ATOM records:

>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii}
nanieqsyvevnenerfealcrllknkefyglvfcktkrdtkelasmlrdigfkagaihg
dlsqsqrekvirlfkqkkiriliatdvmsrgidvndlncvinyhlpqnpesymhrigrtg
ragkkgkaisiinrreykklryieramklkikklk

Timeline for d1hv8a2:

• d1hv8a2 first appeared (with stable ids) in SCOP 1.55
  
• d1hv8a2 appears in SCOP 1.63
  
• d1hv8a2 appears in SCOP 1.67
  
• d1hv8a2 appears in the current release, SCOPe 2.08