Lineage for d4yqmb1 (4yqm B:5-102)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876912Protein Class omega GST [81363] (1 species)
  7. 2876913Species Human (Homo sapiens) [TaxId:9606] [52877] (17 PDB entries)
  8. 2876937Domain d4yqmb1: 4yqm B:5-102 [324058]
    Other proteins in same PDB: d4yqma2, d4yqmb2, d4yqmc2
    automated match to d1eema2
    complexed with 4g9, mes

Details for d4yqmb1

PDB Entry: 4yqm (more details), 2.38 Å

PDB Description: glutathione s-transferase omega 1 bound to covalent inhibitor c1-27
PDB Compounds: (B:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d4yqmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yqmb1 c.47.1.5 (B:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
sarslgkgsappgpvpegsiriysmrfcpfaertrlvlkakgirhevininlknkpewff
kknpfglvpvlensqgqliyesaitceyldeaypgkkl

SCOPe Domain Coordinates for d4yqmb1:

Click to download the PDB-style file with coordinates for d4yqmb1.
(The format of our PDB-style files is described here.)

Timeline for d4yqmb1: