Lineage for d5suzb1 (5suz B:416-509)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693893Family a.4.5.31: DEP domain [63483] (5 proteins)
    membrane-binding domain
  6. 2693909Protein automated matches [324001] (1 species)
    not a true protein
  7. 2693910Species Human (Homo sapiens) [TaxId:9606] [324002] (3 PDB entries)
  8. 2693912Domain d5suzb1: 5suz B:416-509 [324056]
    Other proteins in same PDB: d5suza2, d5suzb2
    automated match to d1fsha_

Details for d5suzb1

PDB Entry: 5suz (more details), 1.84 Å

PDB Description: domain-swapped dimer of human dishevelled2 dep domain: c-centered monoclinic crystal form crystallised from monomeric fraction
PDB Compounds: (B:) Segment polarity protein dishevelled homolog DVL-2

SCOPe Domain Sequences for d5suzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5suzb1 a.4.5.31 (B:416-509) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glsvhtdmasvtkamaapesglevrdrmwlkitipnaflgsdvvdwlyhhvegfperrea
rkyasgllkaglirhtvnkitfseqcyyvfgdls

SCOPe Domain Coordinates for d5suzb1:

Click to download the PDB-style file with coordinates for d5suzb1.
(The format of our PDB-style files is described here.)

Timeline for d5suzb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5suzb2