Lineage for d4z9ca_ (4z9c A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606368Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2606369Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2606665Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2606666Protein automated matches [191197] (12 species)
    not a true protein
  7. 2606728Species Escherichia coli [TaxId:562] [324051] (1 PDB entry)
  8. 2606729Domain d4z9ca_: 4z9c A: [324052]
    automated match to d4k6lg_
    complexed with po4

Details for d4z9ca_

PDB Entry: 4z9c (more details), 2.35 Å

PDB Description: ecpltab oxidized
PDB Compounds: (A:) Pertussis toxin-like subunit ArtA

SCOPe Domain Sequences for d4z9ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z9ca_ d.166.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
tdfvyrvdsrppeeifrdgfrshgfnrnlqqhlrgdscaagsrdsafiatttslietyni
arqyysssgfhgrlyryrirannifypiqpsvnyltqrgitfsgferimmreqneivave
hipgeniveaveltydrfnsqvsdgpgttnaryvpgstfvnpgvipqlvvptvsvrerin
afgslisacfalkgvrrdglnkratyyepefydargvlkeiik

SCOPe Domain Coordinates for d4z9ca_:

Click to download the PDB-style file with coordinates for d4z9ca_.
(The format of our PDB-style files is described here.)

Timeline for d4z9ca_: