Lineage for d1hv8a1 (1hv8 A:3-210)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 70260Family c.37.1.13: Extended AAA-ATPase domain [52700] (15 proteins)
  6. 70375Protein Putative DEAD box RNA helicase [52704] (1 species)
  7. 70376Species Archaeon Methanococcus jannaschii [TaxId:2190] [52705] (1 PDB entry)
  8. 70377Domain d1hv8a1: 1hv8 A:3-210 [32405]

Details for d1hv8a1

PDB Entry: 1hv8 (more details), 3 Å

PDB Description: crystal structure of a dead box protein from the hyperthermophile methanococcus jannaschii

SCOP Domain Sequences for d1hv8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv8a1 c.37.1.13 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii}
veymnfnelnlsdnilnairnkgfekptdiqmkviplflndeynivaqartgsgktasfa
iplielvnenngieaiiltptrelaiqvadeieslkgnknlkiakiyggkaiypqikalk
nanivvgtpgrildhinrgtlnlknvkyfildeademlnmgfikdvekilnacnkdkril
lfsatmpreilnlakkymgdysfikaki

SCOP Domain Coordinates for d1hv8a1:

Click to download the PDB-style file with coordinates for d1hv8a1.
(The format of our PDB-style files is described here.)

Timeline for d1hv8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hv8a2