Lineage for d5gpga1 (5gpg A:109-224)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941432Protein FKBP25 [54543] (1 species)
  7. 2941433Species Human (Homo sapiens) [TaxId:9606] [54544] (3 PDB entries)
  8. 2941434Domain d5gpga1: 5gpg A:109-224 [324038]
    Other proteins in same PDB: d5gpga2, d5gpgb1, d5gpgb2
    automated match to d1pbka_
    complexed with rap

Details for d5gpga1

PDB Entry: 5gpg (more details), 1.67 Å

PDB Description: co-crystal structure of the fk506 binding domain of human fkbp25, rapamycin and the frb domain of human mtor
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP3

SCOPe Domain Sequences for d5gpga1:

Sequence, based on SEQRES records: (download)

>d5gpga1 d.26.1.1 (A:109-224) FKBP25 {Human (Homo sapiens) [TaxId: 9606]}
pkytksvlkkgdktnfpkkgdvvhcwytgtlqdgtvfdtniqtsakkkknakplsfkvgv
gkvirgwdealltmskgekarleiepewaygkkgqpdakippnakltfevelvdid

Sequence, based on observed residues (ATOM records): (download)

>d5gpga1 d.26.1.1 (A:109-224) FKBP25 {Human (Homo sapiens) [TaxId: 9606]}
pkytksvlkkgdktnfpkkgdvvhcwytgtlqdgtvfdtniqnakplsfkvgvgkvirgw
dealltmskgekarleiepewaygkkgqpdakippnakltfevelvdid

SCOPe Domain Coordinates for d5gpga1:

Click to download the PDB-style file with coordinates for d5gpga1.
(The format of our PDB-style files is described here.)

Timeline for d5gpga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gpga2