Lineage for d4yqua2 (4yqu A:103-241)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713157Protein Class omega GST [81352] (1 species)
  7. 2713158Species Human (Homo sapiens) [TaxId:9606] [47632] (17 PDB entries)
  8. 2713165Domain d4yqua2: 4yqu A:103-241 [324036]
    Other proteins in same PDB: d4yqua1, d4yqub1
    automated match to d1eema1
    complexed with 4gb, mes

Details for d4yqua2

PDB Entry: 4yqu (more details), 1.94 Å

PDB Description: glutathione s-transferase omega 1 bound to covalent inhibitor c1-31
PDB Compounds: (A:) Glutathione S-transferase omega-1

SCOPe Domain Sequences for d4yqua2:

Sequence, based on SEQRES records: (download)

>d4yqua2 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
lpddpyekacqkmilelfskvpslvgsfirsqnkedyaglkeefrkeftkleevltnkkt
tffggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdw
qgflelylqnspeacdygl

Sequence, based on observed residues (ATOM records): (download)

>d4yqua2 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}
lpddpyekacqkmilelfskvpslvgsfirkedyaglkeefrkeftkleevltnkkttff
ggnsismidyliwpwferleamklnecvdhtpklklwmaamkedptvsalltsekdwqgf
lelylqnspeacdygl

SCOPe Domain Coordinates for d4yqua2:

Click to download the PDB-style file with coordinates for d4yqua2.
(The format of our PDB-style files is described here.)

Timeline for d4yqua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yqua1