Lineage for d5syoc_ (5syo C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2084600Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2084601Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2085014Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2085015Protein automated matches [193506] (6 species)
    not a true protein
  7. 2085040Species Aplysia californica, [TaxId:6500] [324020] (1 PDB entry)
  8. 2085043Domain d5syoc_: 5syo C: [324034]
    Other proteins in same PDB: d5syoa2, d5syoe2
    automated match to d2w8gc_
    complexed with c5e

Details for d5syoc_

PDB Entry: 5syo (more details), 2 Å

PDB Description: crystal structure of a chimeric acetylcholine binding protein from aplysia californica (ac-achbp) containing loop c from the human alpha 3 nicotinic acetylcholine receptor in complex with cytisine
PDB Compounds: (C:) soluble acetylcholine receptor, neuronal acetylcholine receptor subunit alpha-3 chimera

SCOPe Domain Sequences for d5syoc_:

Sequence, based on SEQRES records: (download)

>d5syoc_ b.96.1.0 (C:) automated matches {Aplysia californica, [TaxId: 6500]}
sqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwk
lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
ykhdikyncceeiypdvvlvvkfrer

Sequence, based on observed residues (ATOM records): (download)

>d5syoc_ b.96.1.0 (C:) automated matches {Aplysia californica, [TaxId: 6500]}
sqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwklnsl
mwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrlsf
mcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqykhd
ikyncceeiypdvvlvvkfrer

SCOPe Domain Coordinates for d5syoc_:

Click to download the PDB-style file with coordinates for d5syoc_.
(The format of our PDB-style files is described here.)

Timeline for d5syoc_: