Class b: All beta proteins [48724] (177 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (6 species) not a true protein |
Species Aplysia californica, [TaxId:6500] [324020] (1 PDB entry) |
Domain d5syoc_: 5syo C: [324034] Other proteins in same PDB: d5syoa2, d5syoe2 automated match to d2w8gc_ complexed with c5e |
PDB Entry: 5syo (more details), 2 Å
SCOPe Domain Sequences for d5syoc_:
Sequence, based on SEQRES records: (download)
>d5syoc_ b.96.1.0 (C:) automated matches {Aplysia californica, [TaxId: 6500]} sqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwk lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq ykhdikyncceeiypdvvlvvkfrer
>d5syoc_ b.96.1.0 (C:) automated matches {Aplysia californica, [TaxId: 6500]} sqanlmrlksdlfnypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwklnsl mwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrlsf mcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqykhd ikyncceeiypdvvlvvkfrer
Timeline for d5syoc_: