Lineage for d1uaab1 (1uaa B:2-307)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870681Protein DEXX box DNA helicase [52701] (2 species)
    each AAA domain contains an all-alpha insert subdomain
  7. 2870694Species Escherichia coli, RepD [TaxId:562] [52703] (1 PDB entry)
  8. 2870697Domain d1uaab1: 1uaa B:2-307 [32403]
    protein/DNA complex
    has additional subdomain(s) that are not in the common domain

Details for d1uaab1

PDB Entry: 1uaa (more details), 3 Å

PDB Description: e. coli rep helicase/dna complex
PDB Compounds: (B:) protein (ATP-dependent DNA helicase rep.)

SCOPe Domain Sequences for d1uaab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uaab1 c.37.1.19 (B:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}
rlnpgqqqavefvtgpclvlagagsgktrvitnkiahlirgcgyqarhiaavtftnkaar
emkervgqtlgrkearglmistfhtlgldiikreyaalgmkanfslfddtdqlallkelt
eglieddkvllqqlistisnwkndlktpsqaaasaigerdrifahcyglydahlkacnvl
dfddlillptlllqaneevrkrwqnkiryllvdeyqdtntsqyelvkllvgsrarftvvg
dddqsiyswrgarpqnlvllsqdfpalkvikleqnyrssgrilkaaniliannphvfekr
lfselg

SCOPe Domain Coordinates for d1uaab1:

Click to download the PDB-style file with coordinates for d1uaab1.
(The format of our PDB-style files is described here.)

Timeline for d1uaab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uaab2