Lineage for d5syoa1 (5syo A:1-206)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2408110Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2408111Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2408524Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2408525Protein automated matches [193506] (5 species)
    not a true protein
  7. 2408526Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (60 PDB entries)
  8. 2408697Domain d5syoa1: 5syo A:1-206 [324021]
    Other proteins in same PDB: d5syoa2, d5syoe2
    automated match to d2w8gc_
    complexed with c5e

Details for d5syoa1

PDB Entry: 5syo (more details), 2 Å

PDB Description: crystal structure of a chimeric acetylcholine binding protein from aplysia californica (ac-achbp) containing loop c from the human alpha 3 nicotinic acetylcholine receptor in complex with cytisine
PDB Compounds: (A:) soluble acetylcholine receptor, neuronal acetylcholine receptor subunit alpha-3 chimera

SCOPe Domain Sequences for d5syoa1:

Sequence, based on SEQRES records: (download)

>d5syoa1 b.96.1.0 (A:1-206) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qykhdikyncceeiypdvvlvvkfre

Sequence, based on observed residues (ATOM records): (download)

>d5syoa1 b.96.1.0 (A:1-206) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfypgptkddpltvtlgftlqdivkadsstnevdlvyweqqrwklnsl
mwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqrlsf
mcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqykhd
ikyeeiypdvvlvvkfre

SCOPe Domain Coordinates for d5syoa1:

Click to download the PDB-style file with coordinates for d5syoa1.
(The format of our PDB-style files is described here.)

Timeline for d5syoa1: