Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.31: DEP domain [63483] (5 proteins) membrane-binding domain |
Protein automated matches [324001] (1 species) not a true protein |
Species Homo sapiens [TaxId:9606] [324002] (3 PDB entries) |
Domain d5lnpa1: 5lnp A:416-508 [324009] Other proteins in same PDB: d5lnpa2, d5lnpb2, d5lnpc2, d5lnpd2 automated match to d1fsha_ complexed with so4 |
PDB Entry: 5lnp (more details), 1.99 Å
SCOPe Domain Sequences for d5lnpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lnpa1 a.4.5.31 (A:416-508) automated matches {Homo sapiens [TaxId: 9606]} glsvhtdmasvtkamaapesglevrdrmwlkitipnaflgsdvvdwlyhhvegfperrea rkyasgllkaglirhtvnkitfseqcyyvfgdl
Timeline for d5lnpa1: