Lineage for d5i7xa_ (5i7x A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2707046Domain d5i7xa_: 5i7x A: [324006]
    automated match to d4uita_
    protein/RNA complex; complexed with 67b

Details for d5i7xa_

PDB Entry: 5i7x (more details), 1.18 Å

PDB Description: brd9 in complex with cpd2 (n,n-dimethyl-3-(6-methyl-7-oxo-6,7-dihydro- 1h-pyrrolo[2,3-c]pyridin-4-yl)benzamide)
PDB Compounds: (A:) Bromodomain-containing protein 9

SCOPe Domain Sequences for d5i7xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i7xa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyks
vtefkadfklmcdnamtynrpdtvyyklakkilhagfkmms

SCOPe Domain Coordinates for d5i7xa_:

Click to download the PDB-style file with coordinates for d5i7xa_.
(The format of our PDB-style files is described here.)

Timeline for d5i7xa_: