SCOPe 2.06: Domain d5klvh_: 5klv H:

Lineage for d5klvh_ (5klv H:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family)
   location - intermembrane side of the bc1 complex
   automatically mapped to Pfam PF02320

5. Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
   "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1

6. Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81526] (13 PDB entries)
   Uniprot P00126

8. Domain d5klvh_: 5klv H: [323991]
   Other proteins in same PDB: d5klva1, d5klva2, d5klvb1, d5klvb2, d5klvc1, d5klvc2, d5klvd1, d5klvd2, d5klve1, d5klve2, d5klvg_, d5klvj_, d5klvk_
   automated match to d1ntmh_
   complexed with 6pe, 8pe, cdl, cl, fes, fnm, gol, hec, hem, pef, px4

Details for d5klvh_

PDB Entry: 5klv, 2.65 Å

PDB Description: structure of bos taurus cytochrome bc1 with fenamidone inhibited

PDB Compounds: (H:) cytochrome b-c1 complex subunit 6, mitochondrial

SCOPe Domain Sequences for d5klvh_:

Sequence; same for both SEQRES and ATOM records:

>d5klvh_ f.28.1.1 (H:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
elvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvah
klfnslk

Timeline for d5klvh_:

• d5klvh_ is new in SCOPe 2.06-stable
  
• d5klvh_ appears in SCOPe 2.07
  
• d5klvh_ appears in the current release, SCOPe 2.08