Lineage for d3pjra1 (3pjr A:4-318)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 485391Family c.37.1.19: Tandem AAA-ATPase domain [81268] (10 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 485396Protein DEXX box DNA helicase [52701] (2 species)
    each AAA domain contains an all-alpha insert subdomain
  7. 485397Species Bacillus stearothermophilus, PcrA [TaxId:1422] [52702] (5 PDB entries)
  8. 485407Domain d3pjra1: 3pjr A:4-318 [32399]

Details for d3pjra1

PDB Entry: 3pjr (more details), 3.3 Å

PDB Description: helicase substrate complex

SCOP Domain Sequences for d3pjra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pjra1 c.37.1.19 (A:4-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA}
lseqllahlnkeqqeavrttegpllimagagsgktrvlthriaylmaekhvapwnilait
ftnkaaremrervqsllggaaedvwistfhsmcvrilrrdidriginrnfsildptdqls
vmktilkeknidpkkfeprtilgtisaaknellppeqfakrastyyekvvsdvyqeyqqr
llrnhsldfddlimttiqlfdrvpdvlhyyqykfqyihideyqdtnraqytlvkklaerf
qnicavgdadqsiyrwrgadiqnilsferdypnakvilleqnyrstkrilqaaneviehn
vnrkpkriwtenpeg

SCOP Domain Coordinates for d3pjra1:

Click to download the PDB-style file with coordinates for d3pjra1.
(The format of our PDB-style files is described here.)

Timeline for d3pjra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3pjra2