SCOPe 2.06: Domain d5klvd2: 5klv D:196-241

Lineage for d5klvd2 (5klv D:196-241)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families)

5. Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)

6. Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81491] (18 PDB entries)
   Uniprot P00125

8. Domain d5klvd2: 5klv D:196-241 [323985]
   Other proteins in same PDB: d5klva1, d5klva2, d5klvb1, d5klvb2, d5klvc1, d5klvc2, d5klvd1, d5klve1, d5klve2, d5klvg_, d5klvh_, d5klvj_, d5klvk_
   automated match to d1ntmd2
   complexed with 6pe, 8pe, cdl, cl, fes, fnm, gol, hec, hem, pef, px4

Details for d5klvd2

PDB Entry: 5klv, 2.65 Å

PDB Description: structure of bos taurus cytochrome bc1 with fenamidone inhibited

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial

SCOPe Domain Sequences for d5klvd2:

Sequence; same for both SEQRES and ATOM records:

>d5klvd2 f.23.11.1 (D:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus) [TaxId: 9913]}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

Timeline for d5klvd2:

• d5klvd2 is new in SCOPe 2.06-stable
  
• d5klvd2 appears in SCOPe 2.07
  
• d5klvd2 appears in the current release, SCOPe 2.08