Lineage for d5iruc_ (5iru C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2806126Protein automated matches [190191] (2 species)
    not a true protein
  7. 2806127Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)
  8. 2806174Domain d5iruc_: 5iru C: [323983]
    automated match to d4i60a_
    complexed with b9p, nag

Details for d5iruc_

PDB Entry: 5iru (more details), 2 Å

PDB Description: crystal structure of avidin in complex with 1-biotinylpyrene
PDB Compounds: (C:) Avidin

SCOPe Domain Sequences for d5iruc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iruc_ b.61.1.1 (C:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rl

SCOPe Domain Coordinates for d5iruc_:

Click to download the PDB-style file with coordinates for d5iruc_.
(The format of our PDB-style files is described here.)

Timeline for d5iruc_: