Lineage for d5i38b_ (5i38 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004630Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2004631Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2004698Family a.86.1.0: automated matches [254307] (1 protein)
    not a true family
  6. 2004699Protein automated matches [254708] (2 species)
    not a true protein
  7. 2004700Species Bacillus megaterium [TaxId:1404] [255981] (18 PDB entries)
  8. 2004736Domain d5i38b_: 5i38 B: [323981]
    automated match to d4p6ra_
    complexed with cu, koj

Details for d5i38b_

PDB Entry: 5i38 (more details), 2.6 Å

PDB Description: crystal structure of tyrosinase from bacillus megaterium with inhibitor kojic acid in the active site
PDB Compounds: (B:) tyrosinase

SCOPe Domain Sequences for d5i38b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i38b_ a.86.1.0 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydiel

SCOPe Domain Coordinates for d5i38b_:

Click to download the PDB-style file with coordinates for d5i38b_.
(The format of our PDB-style files is described here.)

Timeline for d5i38b_: