Lineage for d2pjr.2 (2pjr F:1019-1247,G:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1365514Family c.37.1.19: Tandem AAA-ATPase domain [81268] (24 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 1365523Protein DEXX box DNA helicase [52701] (2 species)
    each AAA domain contains an all-alpha insert subdomain
  7. 1365524Species Bacillus stearothermophilus, PcrA [TaxId:1422] [52702] (5 PDB entries)
  8. 1365531Domain d2pjr.2: 2pjr F:1019-1247,G: [32398]
    protein/DNA complex; complexed with so4

Details for d2pjr.2

PDB Entry: 2pjr (more details), 2.9 Å

PDB Description: helicase product complex
PDB Compounds: (F:) protein (helicase pcra), (G:) protein (helicase pcra)

SCOPe Domain Sequences for d2pjr.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g2pjr.2 c.37.1.19 (F:1019-1247,G:) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}
kpilyyeamneadeaqfvagrireavergerryrdfavlyrtnaqsrvmeemllkanipy
qivgglkfydrkeikdilaylrvianpdddlsllriinvpkrgigastidklvryaadhe
lslfealgelemiglgakaagalaafrsqleqwtqlqeyvsvtelveevldksgyremlk
aertieaqsrlenldeflsvtkhfenvsddksliafltdlalisdldelXgdavmlmtlh
aakglefpvvfligmeegifphnrsledddemeeerrlayvgitraeeelvltsaqmrtl
fgniqmdppsrflneipahlletas

SCOPe Domain Coordinates for d2pjr.2:

Click to download the PDB-style file with coordinates for d2pjr.2.
(The format of our PDB-style files is described here.)

Timeline for d2pjr.2: