SCOP 1.57: Domain d2pjrf1: 2pjr F:704-1018

Lineage for d2pjrf1 (2pjr F:704-1018)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families)

5. Family c.37.1.13: Extended AAA-ATPase domain [52700] (15 proteins)

6. Protein DEXX box DNA helicase [52701] (2 species)

7. Species Bacillus stearothermophilus, PcrA [TaxId:1422] [52702] (5 PDB entries)

8. Domain d2pjrf1: 2pjr F:704-1018 [32397]

Details for d2pjrf1

PDB Entry: 2pjr, 2.9 Å

PDB Description: helicase product complex

SCOP Domain Sequences for d2pjrf1:

Sequence; same for both SEQRES and ATOM records:

>d2pjrf1 c.37.1.13 (F:704-1018) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA}
lseqllahlnkeqqeavrttegpllimagagsgktrvlthriaylmaekhvapwnilait
ftnkaaremrervqsllggaaedvwistfhsmcvrilrrdidriginrnfsildptdqls
vmktilkeknidpkkfeprtilgtisaaknellppeqfakrastyyekvvsdvyqeyqqr
llrnhsldfddlimttiqlfdrvpdvlhyyqykfqyihideyqdtnraqytlvkklaerf
qnicavgdadqsiyrwrgadiqnilsferdypnakvilleqnyrstkrilqaaneviehn
vnrkpkriwtenpeg

Timeline for d2pjrf1:

• d2pjrf1 first appeared (with stable ids) in SCOP 1.55
  
• d2pjrf1 appears in SCOP 1.59
  
• d2pjrf1 appears in the current release, SCOPe 2.08