| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
| Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (2 proteins) contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1) automatically mapped to Pfam PF02664 |
| Protein automated matches [323957] (1 species) not a true protein |
| Species Salmonella typhi [TaxId:90370] [323958] (2 PDB entries) |
| Domain d5e68a_: 5e68 A: [323962] Other proteins in same PDB: d5e68b2 automated match to d1j6wb_ complexed with met, pav, zn |
PDB Entry: 5e68 (more details), 1.58 Å
SCOPe Domain Sequences for d5e68a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e68a_ d.185.1.2 (A:) automated matches {Salmonella typhi [TaxId: 90370]}
lldsfavdhtrmqapavrtaktmntphgdaitvfdlrfcipnkevmpekgihtlehlfag
fmrdhlngngveiidispmgcrtgfymsligtpdeqrvadawkaamadvlkvqdqnqipe
lnvyqcgtyqmhslseaqdiarhilerdvrvnsnkelalpkeklqel
Timeline for d5e68a_: