SCOPe 2.06: Domain d5e68a_: 5e68 A:

Lineage for d5e68a_ (5e68 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.2: Autoinducer-2 production protein LuxS [64294] (2 proteins)
   contains additional N-terminal strand; possible relationships to the putative editing domain of ThrRS (d.67.1)
   automatically mapped to Pfam PF02664

6. Protein automated matches [323957] (1 species)
   not a true protein

7. Species Salmonella typhi [TaxId:90370] [323958] (2 PDB entries)

8. Domain d5e68a_: 5e68 A: [323962]
   Other proteins in same PDB: d5e68b2
   automated match to d1j6wb_
   complexed with met, pav, zn

Details for d5e68a_

PDB Entry: 5e68, 1.58 Å

PDB Description: high resolution crystal structure of luxs - quorum sensor molecular complex from salmonella typhi at 1.58 angstroms

PDB Compounds: (A:) S-ribosylhomocysteine lyase

SCOPe Domain Sequences for d5e68a_:

Sequence; same for both SEQRES and ATOM records:

>d5e68a_ d.185.1.2 (A:) automated matches {Salmonella typhi [TaxId: 90370]}
lldsfavdhtrmqapavrtaktmntphgdaitvfdlrfcipnkevmpekgihtlehlfag
fmrdhlngngveiidispmgcrtgfymsligtpdeqrvadawkaamadvlkvqdqnqipe
lnvyqcgtyqmhslseaqdiarhilerdvrvnsnkelalpkeklqel

Timeline for d5e68a_:

• d5e68a_ is new in SCOPe 2.06-stable
  
• d5e68a_ appears in SCOPe 2.07
  
• d5e68a_ appears in the current release, SCOPe 2.08