Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (13 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein DEXX box DNA helicase [52701] (2 species) each AAA domain contains an all-alpha insert subdomain |
Species Bacillus stearothermophilus, PcrA [TaxId:1422] [52702] (5 PDB entries) |
Domain d2pjr.1: 2pjr A:319-548,B: [32396] |
PDB Entry: 2pjr (more details), 2.9 Å
SCOP Domain Sequences for d2pjr.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g2pjr.1 c.37.1.19 (A:319-548,B:) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA} kpilyyeamneadeaqfvagrireavergerryrdfavlyrtnaqsrvmeemllkanipy qivgglkfydrkeikdilaylrvianpdddlsllriinvpkrgigastidklvryaadhe lslfealgelemiglgakaagalaafrsqleqwtqlqeyvsvtelveevldksgyremlk aertieaqsrlenldeflsvtkhfenvsddksliafltdlalisdldeldXgdavmlmtl haakglefpvvfligmeegifphnrsledddemeeerrlayvgitraeeelvltsaqmrt lfgniqmdppsrflneipahlletas
Timeline for d2pjr.1: