Lineage for d5irwd_ (5irw D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2396657Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2396658Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2396659Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2396981Protein automated matches [190191] (2 species)
    not a true protein
  7. 2396982Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)
  8. 2397047Domain d5irwd_: 5irw D: [323956]
    automated match to d4i60a_
    complexed with d9p, nag

Details for d5irwd_

PDB Entry: 5irw (more details), 2.1 Å

PDB Description: crystal structure of avidin in complex with 1-desthiobiotinylpyrene
PDB Compounds: (D:) Avidin

SCOPe Domain Sequences for d5irwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5irwd_ b.61.1.1 (D:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrtqp
tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr
l

SCOPe Domain Coordinates for d5irwd_:

Click to download the PDB-style file with coordinates for d5irwd_.
(The format of our PDB-style files is described here.)

Timeline for d5irwd_: