SCOPe 2.08: Domain d5jcub2: 5jcu B:81-222

Lineage for d5jcub2 (5jcu B:81-222)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (35 PDB entries)
   Uniprot P08263

8. Domain d5jcub2: 5jcu B:81-222 [323951]
   Other proteins in same PDB: d5jcua1, d5jcub1, d5jcuc1, d5jcud1
   automated match to d1k3ya1
   complexed with edo, gvx

Details for d5jcub2

PDB Entry: 5jcu, 1.93 Å

PDB Description: crystal structure of hgsta1-1 with glutathione adduct of phenethyl isothiocyanate and cystein adduct of phenethyl isothiocyanate

PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d5jcub2:

Sequence; same for both SEQRES and ATOM records:

>d5jcub2 a.45.1.1 (B:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvxppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

Timeline for d5jcub2:

• d5jcub2 first appeared in SCOPe 2.06
  
• d5jcub2 appears in SCOPe 2.07