| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
| Protein DEXX box DNA helicase [52701] (2 species) each AAA domain contains an all-alpha insert subdomain |
| Species Bacillus stearothermophilus, PcrA [TaxId:1422] [52702] (5 PDB entries) |
| Domain d2pjra1: 2pjr A:7-318 [32395] protein/DNA complex; complexed with so4 has additional subdomain(s) that are not in the common domain |
PDB Entry: 2pjr (more details), 2.9 Å
SCOPe Domain Sequences for d2pjra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pjra1 c.37.1.19 (A:7-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}
qllahlnkeqqeavrttegpllimagagsgktrvlthriaylmaekhvapwnilaitftn
kaaremrervqsllggaaedvwistfhsmcvrilrrdidriginrnfsildptdqlsvmk
tilkeknidpkkfeprtilgtisaaknellppeqfakrastyyekvvsdvyqeyqqrllr
nhsldfddlimttiqlfdrvpdvlhyyqykfqyihideyqdtnraqytlvkklaerfqni
cavgdadqsiyrwrgadiqnilsferdypnakvilleqnyrstkrilqaaneviehnvnr
kpkriwtenpeg
Timeline for d2pjra1:
View in 3DDomains from other chains: (mouse over for more information) d2pjr.1, d2pjr.2, d2pjr.2, d2pjrf1 |