Lineage for d5jcud2 (5jcu D:81-222)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1998816Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1998829Protein Class alpha GST [81349] (8 species)
  7. 1998842Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (30 PDB entries)
    Uniprot P08263
  8. 1998899Domain d5jcud2: 5jcu D:81-222 [323949]
    Other proteins in same PDB: d5jcua1, d5jcub1, d5jcuc1, d5jcud1
    automated match to d1k3ya1
    complexed with edo, gvx

Details for d5jcud2

PDB Entry: 5jcu (more details), 1.93 Å

PDB Description: crystal structure of hgsta1-1 with glutathione adduct of phenethyl isothiocyanate and cystein adduct of phenethyl isothiocyanate
PDB Compounds: (D:) glutathione s-transferase a1

SCOPe Domain Sequences for d5jcud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jcud2 a.45.1.1 (D:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvxppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleearkifrf

SCOPe Domain Coordinates for d5jcud2:

Click to download the PDB-style file with coordinates for d5jcud2.
(The format of our PDB-style files is described here.)

Timeline for d5jcud2: