Lineage for d5irub_ (5iru B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2073248Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2073249Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2073250Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2073570Protein automated matches [190191] (2 species)
    not a true protein
  7. 2073571Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)
  8. 2073628Domain d5irub_: 5iru B: [323944]
    automated match to d4i60a_
    complexed with b9p, nag

Details for d5irub_

PDB Entry: 5iru (more details), 2 Å

PDB Description: crystal structure of avidin in complex with 1-biotinylpyrene
PDB Compounds: (B:) Avidin

SCOPe Domain Sequences for d5irub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5irub_ b.61.1.1 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrtq
ptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginift
rl

SCOPe Domain Coordinates for d5irub_:

Click to download the PDB-style file with coordinates for d5irub_.
(The format of our PDB-style files is described here.)

Timeline for d5irub_: