Lineage for d5hp7a_ (5hp7 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525086Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2525290Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2525291Protein automated matches [190935] (19 species)
    not a true protein
  7. 2525383Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [323904] (2 PDB entries)
  8. 2525384Domain d5hp7a_: 5hp7 A: [323938]
    automated match to d3l7qa_

Details for d5hp7a_

PDB Entry: 5hp7 (more details), 2 Å

PDB Description: crystal structures of rida in the apo form
PDB Compounds: (A:) Reactive Intermediate Deaminase A, chloroplastic

SCOPe Domain Sequences for d5hp7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hp7a_ d.79.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sqaikannlvflsgvlglipetgkfvsesvedqteqvlknmgeilkasgadyssvvktti
mladladfktvneiyakyfpapsparstyqvaalplnakieieciatl

SCOPe Domain Coordinates for d5hp7a_:

Click to download the PDB-style file with coordinates for d5hp7a_.
(The format of our PDB-style files is described here.)

Timeline for d5hp7a_: