![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) ![]() |
![]() | Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins) |
![]() | Protein automated matches [190191] (2 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries) |
![]() | Domain d5irwb_: 5irw B: [323931] automated match to d4i60a_ complexed with d9p, nag |
PDB Entry: 5irw (more details), 2.1 Å
SCOPe Domain Sequences for d5irwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5irwb_ b.61.1.1 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} kcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtqntinkrtqp tfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginiftr l
Timeline for d5irwb_: