SCOPe 2.07: Domain d5hrxa_: 5hrx A:

Lineage for d5hrxa_ (5hrx A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)

8. Domain d5hrxa_: 5hrx A: [323930]
   automated match to d3g0ja_
   complexed with 64f, edo

Details for d5hrxa_

PDB Entry: 5hrx, 1.73 Å

PDB Description: crystal structure of the fifth bromodomain of human pb1 in complex with 1-butylisochromeno[3,4-c]pyrazol-5(2h)-one) compound

PDB Compounds: (A:) Protein polybromo-1

SCOPe Domain Sequences for d5hrxa_:

Sequence; same for both SEQRES and ATOM records:

>d5hrxa_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikkpmdmekirshm
mankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrdl

Timeline for d5hrxa_:

• d5hrxa_ first appeared in SCOPe 2.06
  
• d5hrxa_ appears in the current release, SCOPe 2.08